Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Protease HtpX (htpX)

This Recombinant Pseudomonas fluorescens Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q4K8U3

Expression Region

1-295

Origin

Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFLATNLAVVLIASITLSLFGFNGFMAANGVDLNLNQLLIFCAVFGFAGSLFSLF ISKWMAKMSTSTQIITQPRTRHEQWLLHTVEQLSREAGIKMPEVGIFPAYEANAFATGWN KNDALVAVSQGLLERFSPDEVKAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIIGN FVDKVIFKNEEGQGIAYYVATIFAELVLGILASAIVMWFSRKREYRADEAGARLAGTNAM IGALQRLRSEQGLPVHMPDTLNAFGINGGIKQGLARMFMSHPPLEERIEALRRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Faim2-set siRNA/shRNA/RNAi Lentivector (Mouse)
19675094 4x 500 ng

Faim2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
MFI2 CRISPR Knock Out 293T Cell Line (Human)
28443141 1x 10^6 Cells / 1.0 mL

MFI2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human PLEKHG3 Knockout HEK293T cell line
GTR15402903 1 Vial

Human PLEKHG3 Knockout HEK293T cell line

Sign In for Pricing
View Details
BCL-2 (Phospho-Thr74) Antibody
MBS9416833-01 0.05 mL

BCL-2 (Phospho-Thr74) Antibody

Sign In for Pricing
View Details
BCL-2 (Phospho-Thr74) Antibody
MBS9416833-02 0.1 mL

BCL-2 (Phospho-Thr74) Antibody

Sign In for Pricing
View Details
BCL-2 (Phospho-Thr74) Antibody
MBS9416833-03 5x 0.1 mL

BCL-2 (Phospho-Thr74) Antibody

Sign In for Pricing
View Details