Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Protease HtpX (htpX)

This Recombinant Pseudomonas fluorescens Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q4K8U3

Expression Region

1-295

Origin

Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFLATNLAVVLIASITLSLFGFNGFMAANGVDLNLNQLLIFCAVFGFAGSLFSLF ISKWMAKMSTSTQIITQPRTRHEQWLLHTVEQLSREAGIKMPEVGIFPAYEANAFATGWN KNDALVAVSQGLLERFSPDEVKAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIIGN FVDKVIFKNEEGQGIAYYVATIFAELVLGILASAIVMWFSRKREYRADEAGARLAGTNAM IGALQRLRSEQGLPVHMPDTLNAFGINGGIKQGLARMFMSHPPLEERIEALRRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2310007B03Rik Protein Vector (Mouse) (pPM-C-HA)
PV147936 500 ng

2310007B03Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ASS1 Human Over-expression Lysate
orb1376443 20 µg

ASS1 Human Over-expression Lysate

Sign In for Pricing
View Details
(Z) -13-Octadecen-1-ol
HY-W778834-01 250 mg

(Z) -13-Octadecen-1-ol

Sign In for Pricing
View Details
(Z) -13-Octadecen-1-ol
HY-W778834-02 1 g

(Z) -13-Octadecen-1-ol

Sign In for Pricing
View Details
(Z) -13-Octadecen-1-ol
HY-W778834-03 5 g

(Z) -13-Octadecen-1-ol

Sign In for Pricing
View Details
pYX-Asc-BAP1 Plasmid
PVT31926 2 µg

pYX-Asc-BAP1 Plasmid

Sign In for Pricing
View Details