Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Protease HtpX (htpX)

This Recombinant Pseudomonas fluorescens Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q4K8U3

Expression Region

1-295

Origin

Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFLATNLAVVLIASITLSLFGFNGFMAANGVDLNLNQLLIFCAVFGFAGSLFSLF ISKWMAKMSTSTQIITQPRTRHEQWLLHTVEQLSREAGIKMPEVGIFPAYEANAFATGWN KNDALVAVSQGLLERFSPDEVKAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIIGN FVDKVIFKNEEGQGIAYYVATIFAELVLGILASAIVMWFSRKREYRADEAGARLAGTNAM IGALQRLRSEQGLPVHMPDTLNAFGINGGIKQGLARMFMSHPPLEERIEALRRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1
MBS143397-01 0.002 mg

Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1

Sign In for Pricing
View Details
Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1
MBS143397-02 0.01 mg

Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1

Sign In for Pricing
View Details
Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1
MBS143397-03 1 mg

Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1

Sign In for Pricing
View Details
Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1
MBS143397-04 5x 1 mg

Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1

Sign In for Pricing
View Details
Anti-ZFP1 Antibody
CTA2055-01 30 µL

Anti-ZFP1 Antibody

Sign In for Pricing
View Details
Anti-ZFP1 Antibody
CTA2055-02 50 μL

Anti-ZFP1 Antibody

Sign In for Pricing
View Details