Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Protein YIF1B-A (yif1b-a)

This Recombinant Xenopus laevis Protein YIF1B-A (yif1b-a) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Protein YIF1B-A, YIP1-interacting factor homolog B-A

UniProt

Q6GN58

Expression Region

1-300

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQESSFRAPPKRRARGSNPNVSTPHQLFDDTSGGPVPHGGEYPNHSSPALGIPAQAFLS EPMSNFAMAYGSSLASQGKEMMDKNIDRIIPVSKIKYYFAVDTVYVGKKIGLLMFPYMHQ DWEVRYQQDTPVAPRFDINAPDLYIPVMAFVTYILVAGLALGTQSRFSPEILGMQASSAL AWLIVEVLAILLSLYLVTVNTDLTTVDLVAFTGYKYVGMISGVISGLLFGKTGYYIVLAW CCISIVFFMIRTLRLKILSEAAAEGVLVRGARNQLRMYLTMAIAAVQPIFMYWLTYHLVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-100 1x 100 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details