Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Protease HtpX (htpX)

This Recombinant Acinetobacter baumannii Protease HtpX (htpX) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B0VDQ0

Expression Region

1-301

Origin

Acinetobacter baumannii (strain AYE)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIGLFLLTNLAVLVVAGIILSLFGVGSYHGAGGLNLGNLLVICFVFGMVGSLVSLFMS KWMAKKTTGTELIDPNAPRNQAESWLLQTVAELSQRAGINMPEVGIFPSYQSNAFATGWN KNDALVAVSSGLLERMNKDELRAVLAHEIGHVANGDMVTLALIQGVVNAFVMFFARVVGD FIDRNVFGRQDNEAPGMGYFIITMVLDIVFGILASAIVMWFSRYREYRADEAGARLAGKQ AMISALLRLQAETELPDQMPKEMKAFAIAEGKEQGFSLAALFQTHPTIEQRVAALHQLDC P

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAUSP Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-4281R-BF680 100 µL

HAUSP Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Schisanhenol B
MBS5761109 Inquire

Schisanhenol B

Sign In for Pricing
View Details
Furan-2-boronic acid, pinacol ester
OR360000-01 1 g

Furan-2-boronic acid, pinacol ester

Sign In for Pricing
View Details
Furan-2-boronic acid, pinacol ester
OR360000-02 5 g

Furan-2-boronic acid, pinacol ester

Sign In for Pricing
View Details
Furan-2-boronic acid, pinacol ester
OR360000-03 100 g

Furan-2-boronic acid, pinacol ester

Sign In for Pricing
View Details
Furan-2-boronic acid, pinacol ester
OR360000-04 500 g

Furan-2-boronic acid, pinacol ester

Sign In for Pricing
View Details