Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cardiolipin synthase (Crls1)

This Recombinant Mouse Cardiolipin synthase (Crls1) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CLS, EC= 2.7.8.-

UniProt

Q80ZM8

Expression Region

1-303

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAWRVARGAWGPLRVALRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRL PGAGPRTHCSGAGKAAPEPAAGGGGAAAQAPSARWVPASAASSYENPWTIPNLLSMTRIG LAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISI LYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPT FISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVI KGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGXB4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0974008 1.0 µg DNA

HMGXB4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal SPCS2 Antibody [Alexa Fluor 405]
NBP3-06490AF405 0.1 mL

Rabbit Polyclonal SPCS2 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
COMMD6 CRISPR Activation Plasmid (h)
sc-414934-ACT 20 µg

COMMD6 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Goat Anti Mouse Igm Mu Chain Polyclonal Antibody,HRP
CPBT-67997GM-01 1 mg

Goat Anti Mouse Igm Mu Chain Polyclonal Antibody,HRP

Sign In for Pricing
View Details
Goat Anti Mouse Igm Mu Chain Polyclonal Antibody,HRP
CPBT-67997GM-02 500ul

Goat Anti Mouse Igm Mu Chain Polyclonal Antibody,HRP

Sign In for Pricing
View Details
Anti-Human CD209 Antibody (2B8), PE
MBS1585109-01 50 Tests

Anti-Human CD209 Antibody (2B8), PE

Sign In for Pricing
View Details