Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cardiolipin synthase (Crls1)

This Recombinant Mouse Cardiolipin synthase (Crls1) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CLS, EC= 2.7.8.-

UniProt

Q80ZM8

Expression Region

1-303

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAWRVARGAWGPLRVALRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRL PGAGPRTHCSGAGKAAPEPAAGGGGAAAQAPSARWVPASAASSYENPWTIPNLLSMTRIG LAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISI LYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPT FISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVI KGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Epoxide hydrolase/EPHX1 Antibody Picoband®, HRP Conjugate
A00899-1-HRP 100 µg/Vial

Anti-Epoxide hydrolase/EPHX1 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Mouse Pisd activation kit by CRISPRa
GA216593 1 Kit

Mouse Pisd activation kit by CRISPRa

Sign In for Pricing
View Details
W/W019/NL329/TW-148X210-1 Electrical & Equipment Safety Signs & Labels (Adhesive)
235906 1 Pack (1 Panel (s) x 1 Pack)

W/W019/NL329/TW-148X210-1 Electrical & Equipment Safety Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Olfr612 Protein Vector (Mouse) (pPM-C-HA)
33302024 500 ng

Olfr612 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TTC19 Rabbit Polyclonal Antibody (FITC)
orb2130559 100 µL

TTC19 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
C3orf55 AAV Vector (Human) (CMV)
14490101 1 µg

C3orf55 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details