Recombinant Mouse Cardiolipin synthase (Crls1)
This Recombinant Mouse Cardiolipin synthase (Crls1) spans the amino acid sequence from region 1-303.
Product Specifications
Product Name Alternative
Cardiolipin synthase, CLS, EC= 2.7.8.-
UniProt
Q80ZM8
Expression Region
1-303
Origin
Mus musculus (Mouse)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLAWRVARGAWGPLRVALRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRL PGAGPRTHCSGAGKAAPEPAAGGGGAAAQAPSARWVPASAASSYENPWTIPNLLSMTRIG LAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISI LYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPT FISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVI KGK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
137896-Biotin 100 µL
Connexin-26 (GJB2, Gap Junction beta-2 Protein, Cx26) (Biotin)
Sign In for Pricing
View Details 303524 100 µg
Peroxiredoxin 1 (Hbp23, Heme Binding 23kD Protein, Macrophage 23kD Stress Protein, Macrophase Stress Protein 22kD, Macrophase Stress Protein 23kd, MSP23, Natural Killer Cell Enhancing Factor A, Natural Killer Cell-enhancing Factor A, Natural Killer Enhancing Factor A, NKEF A, NKEF-A, NkefA, OSF3, Osteoblast Specific Factor 3, PAG, Paga, PAGB, Peroxiredoxin-1, Prdx 1, Prdx1, PRDX1_HUMAN, Proliferation Associated Gene A, Proliferation Associated Protein PAG, Proliferation-associated Gene Protein, PrxI, Tdpx 2, Tdpx2, TDX2, Thioredoxin Dependent Peroxide Reductase 2, Thioredoxin Peroxidase 2, Thioredoxin-dependent Peroxide Reductase 2, TPxA, Trx Dependent Peroxide Reductase 2)
Sign In for Pricing
View Details bs-3438R-Cy5.5 100 µL
Phospho-TAK1 (Thr187) Polyclonal Antibody, Cy5.5 Conjugated
Sign In for Pricing
View Details