Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. indica Putative secretory carrier-associated membrane protein 1 (SCAMP1)

This Recombinant Oryza sativa subsp. indica Putative secretory carrier-associated membrane protein 1 (SCAMP1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Putative secretory carrier-associated membrane protein 1, Secretory carrier membrane protein 1

UniProt

A2YMP7

Expression Region

1-306

Origin

Oryza sativa subsp. indica (Rice)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGRYDSNPFEEDDVNPFSEQARGKAGGQPSYGGGAFYMPNPRNVPSMSSNSRLSPLPPE PAAFGATVDIPLDSSKDLKNREKELQAREAELNKREKELKRREEAAARAGIVIEEKNWPP FLPLIHHDITNEIPSHLQRMQYVAFASFLGLACCLFWNVIAVTSAWVKGEGVKIWLLAII YFISGVPGAYVLWYRPLYNAMRTDSALKFGLFFLVYLFHILFCVFSAVAPPVVFEGKSLA GILPAIDLISKNALVGIFYFVGFGLFCVESLLSIWVIQQVYMYFRGSGKAAEMKRDATRG AMRAAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-100 1x 100 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
BNC740525-500 1x 500 µL

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), Biotin conjugate, 0.1mg/mL
BNCB0333-500 1x 500 µL

CD8 (RIV11), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details