Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. indica Putative secretory carrier-associated membrane protein 1 (SCAMP1)

This Recombinant Oryza sativa subsp. indica Putative secretory carrier-associated membrane protein 1 (SCAMP1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Putative secretory carrier-associated membrane protein 1, Secretory carrier membrane protein 1

UniProt

A2YMP7

Expression Region

1-306

Origin

Oryza sativa subsp. indica (Rice)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGRYDSNPFEEDDVNPFSEQARGKAGGQPSYGGGAFYMPNPRNVPSMSSNSRLSPLPPE PAAFGATVDIPLDSSKDLKNREKELQAREAELNKREKELKRREEAAARAGIVIEEKNWPP FLPLIHHDITNEIPSHLQRMQYVAFASFLGLACCLFWNVIAVTSAWVKGEGVKIWLLAII YFISGVPGAYVLWYRPLYNAMRTDSALKFGLFFLVYLFHILFCVFSAVAPPVVFEGKSLA GILPAIDLISKNALVGIFYFVGFGLFCVESLLSIWVIQQVYMYFRGSGKAAEMKRDATRG AMRAAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDH12 (N-term) Rabbit Polyclonal Antibody
AP11470PU-N 400 µL

CDH12 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GLUT9 (SLC2A9) (NM_001001290) Human Over-expression Lysate
LY400368 100 µg

GLUT9 (SLC2A9) (NM_001001290) Human Over-expression Lysate

Sign In for Pricing
View Details
CAMK2A pThr286 Rabbit Polyclonal Antibody
AP02526PU-S 50 µL

CAMK2A pThr286 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bulk Human IgG3 (IB3) Isotype Control
ICH2256-50mg 50 mg

Bulk Human IgG3 (IB3) Isotype Control

Sign In for Pricing
View Details
GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF594 conjugate, 0.1mg/mL
BNC943168-500 1x 500 µL

GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant CYCS Antibody
RN-14945-01 50 μL

Recombinant CYCS Antibody

Sign In for Pricing
View Details