Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor suppressor candidate 3 (TUSC3)

This Recombinant Human Tumor suppressor candidate 3 (TUSC3) spans the amino acid sequence from region 42-348.

Product Specifications

Product Name Alternative

Tumor suppressor candidate 3, Magnesium uptake/transporter TUSC3, Protein N33

UniProt

Q13454

Expression Region

42-348

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSV CRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPK RADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNN LEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAES HIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYP YSDLDFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MAU (Microalbuminuria) ELISA Kit
E-EL-M0792-01 24 Tests

Mouse MAU (Microalbuminuria) ELISA Kit

Sign In for Pricing
View Details
Mouse MAU (Microalbuminuria) ELISA Kit
E-EL-M0792-02 48 Tests

Mouse MAU (Microalbuminuria) ELISA Kit

Sign In for Pricing
View Details
Mouse MAU (Microalbuminuria) ELISA Kit
E-EL-M0792-03 96 Tests

Mouse MAU (Microalbuminuria) ELISA Kit

Sign In for Pricing
View Details
HES3 Human Gene Knockout Kit (CRISPR)
KN424630 1 Kit

HES3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LMTK3 Human Gene Knockout Kit (CRISPR)
KN223140LP 1 Kit

LMTK3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc1a1 Mouse Gene Knockout Kit (CRISPR)
KN515912 1 Kit

Slc1a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details