Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus vannielii Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Methanococcus vannielii Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

A6UNS5

Expression Region

1-310

Origin

Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPIYLIIADLLDRYIGEPPEKLHPVVFIGNFVKFLEKVFPSTHSVEKLKDLVFGFITV FLTVFTVFLIFFTLELILNLISNYYIKLFSYSLILSFSIGHKSLLEFSKAPIKYIMSGDI KSARKSVQHIVSRDTSTLDEKHVISAAVESSSENITDSIIAPLIYAAIFGLSGAFIYRAV NTMDAMLGYKNEKYRYYGKTAAYLDDILNFIPSRIAGILLIISAPFYGGKIVPAIYGYLK EGFKTPSPNSGYTMAVIANSLSMELEKIGCYKLGKGEITVLKAVNSLKAVDYSVLLFLVI YMVLYFNLIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DMB (Major Histocompatibility Complex, Class II, DM beta, MHC class II HLA-DMB, MHC Class II Antigen HLA-DM beta Chain, OTTHUMP00000029257, Class II Histocompatibility Antigen, M beta Chain, D6S221E, RING7) (MaxLight 650)
207698-ML650 100 µL

HLA-DMB (Major Histocompatibility Complex, Class II, DM beta, MHC class II HLA-DMB, MHC Class II Antigen HLA-DM beta Chain, OTTHUMP00000029257, Class II Histocompatibility Antigen, M beta Chain, D6S221E, RING7) (MaxLight 650)

Sign In for Pricing
View Details
AMIGO2 Rabbit Polyclonal Antibody (Biotin)
orb460317 100 µL

AMIGO2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
AF-4 Polyclonal Antibody
MBS8521121-01 0.1 mg

AF-4 Polyclonal Antibody

Sign In for Pricing
View Details
AF-4 Polyclonal Antibody
MBS8521121-02 0.1 mL (AF635)

AF-4 Polyclonal Antibody

Sign In for Pricing
View Details
AF-4 Polyclonal Antibody
MBS8521121-03 0.1 mL (AF610)

AF-4 Polyclonal Antibody

Sign In for Pricing
View Details
AF-4 Polyclonal Antibody
MBS8521121-04 0.1 mL (AF405S)

AF-4 Polyclonal Antibody

Sign In for Pricing
View Details