Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 4 (SCAMP4)

This Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 4 (SCAMP4) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Secretory carrier-associated membrane protein 4, Secretory carrier membrane protein 4

UniProt

Q75IC7

Expression Region

1-313

Origin

Oryza sativa subsp. japonica (Rice)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGRSRYDNPFEEGGGDEVNPFADKASKGGSAGQSSYSGGAFYTTQSRPSAPPATHLSPL PPEPADFYNDFSTPVDIPMDTSKDMKTREKELLAKEAELNRREKEIKRREEAAARAGIVL EDKNWPPFFPIIHNDIGNEIPVHLQRTQYVAFASLLGLVLCLFWNIICVTAAWIKGEGPK IWFLAVIYFILGCPGAYYLWYRPLYRAMRNESALKFGWFFLFYLVHIAFCVYAAVSPSIL FVGKSLTGIFPAISLIGNTVIVGVFYFLGFAMFCLESLLSMWVIQRVYLYFRGSGKEAEM KREAARSAARAAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-100 1x 100 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-500 1x 500 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF647 conjugate, 0.1mg/mL
BNC472052-100 1x 100 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 3 (MUC3/1154), CF568 conjugate, 0.1mg/mL
BNC681154-100 1x 100 µL

Mucin 3 (MUC3/1154), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1799R), CF740 conjugate, 0.1mg/mL
BNC741799-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/1799R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details