Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Voltage-dependent calcium channel gamma-3 subunit (CACNG3)

This Recombinant Pongo abelii Voltage-dependent calcium channel gamma-3 subunit (CACNG3) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Voltage-dependent calcium channel gamma-3 subunit, Neuronal voltage-gated calcium channel gamma-3 subunit, Transmembrane AMPAR regulatory protein gamma-3, TARP gamma-3

UniProt

Q5R5X2

Expression Region

1-315

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK ESLHNNPANRRTTPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/918), CF640R conjugate, 0.1mg/mL
BNC400918-100 1x 100 µL

CD44 Standard (HCAM/918), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), CF568 conjugate, 0.1mg/mL
BNC682760-500 1x 500 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (C6/372 + 3F7B5), CF640R conjugate, 0.1mg/mL
BNC401228-100 1x 100 µL

CD6 (C6/372 + 3F7B5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2641), CF405S conjugate, 0.1mg/mL
BNC042641-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2641), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF640R conjugate, 0.1mg/mL
BNC401274-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details