Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Uncharacterized protein slr0273 (slr0273)

This Recombinant Synechocystis sp. Uncharacterized protein slr0273 (slr0273) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Uncharacterized protein slr0273

UniProt

P73894

Expression Region

1-316

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKNMSPICPVCGQENDAANRYCSFCGTRFNSSLPSMDLFQAQTVQAPAPEQMVFSGNGQ DLPSLTNHPFWGAIPVLGLLTVLPLGLFIFGMAIDANDWPYAALLVFLLFLFTLLIFLGQ LWGNVSQAREFILSERPLILWRYSPDEWQQLRQAQFSESAEDMQEMAGCAVPFFAGVGTL LGTVLGSVEGFVGAVPGAAIGAMAGYIFGKILVPIATGLNQSTNRELYRTDLPVWVVLAP GEIYYNRQYFRADTIGDRLEGITLDEGALTWLRIETFAPRGSITASFDGNILVPHRMLAT VKAVLPQLQQFISGED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL
BNC470978-100 1x 100 µL

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-100 1x 100 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL
BNC470978-500 1x 500 µL

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (T200/797), CF640R conjugate, 0.1mg/mL
BNC400797-100 1x 100 µL

CD45RO (T200/797), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF647 conjugate, 0.1mg/mL
BNC472883-100 1x 100 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details