Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi B Cobalamin biosynthesis protein CbiB (cbiB)

This Recombinant Salmonella paratyphi B Cobalamin biosynthesis protein CbiB (cbiB) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CbiB

UniProt

A9MT86

Expression Region

1-319

Origin

Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTILAWCIAWVLDFIIGDPQHWPHPVRWIGRLITFVQRIVRRYCPGDKALRIGGGVMWVV VVGATWGVAWGVLALAQRIHPWFGWSVEVWMIFTTLAGRSLARAAQEVERPLRENDLAES RIKLSWIVGRDTSQLQPAQINRGVVETVAENTVDGIIAPLFFLFLGGAPLAMAYKAVNTL DSMVGYKHEKYRAIGMVSARMDDVANYLPARLSWLLLGIAAGLCRLSGWRALRIGWRDRY NHSSPNCAWSEACVAGALGIQLGGPNNYFGERVDKPWIGDAQRDISVDDISRTIRLMWVA STLALALFIAARCGLSGVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS712961 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human PRDM15 activation kit by CRISPRa
GA111943 1 Kit

Human PRDM15 activation kit by CRISPRa

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/839), Biotin conjugate, 0.1mg/mL
BNCB2220-100 1x 100 µL

CD43 (T-Cell Marker) (rSPN/839), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cbln2 Mouse Gene Knockout Kit (CRISPR)
KN502600 1 Kit

Cbln2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRITC Conjugated Goat Polyclonal Antibody to Human Serum
RA-2123-2 2 mL

TRITC Conjugated Goat Polyclonal Antibody to Human Serum

Sign In for Pricing
View Details
Recombinant HIBADH Antibody
RN-14726-01 50 μL

Recombinant HIBADH Antibody

Sign In for Pricing
View Details