Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi B Cobalamin biosynthesis protein CbiB (cbiB)

This Recombinant Salmonella paratyphi B Cobalamin biosynthesis protein CbiB (cbiB) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CbiB

UniProt

A9MT86

Expression Region

1-319

Origin

Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTILAWCIAWVLDFIIGDPQHWPHPVRWIGRLITFVQRIVRRYCPGDKALRIGGGVMWVV VVGATWGVAWGVLALAQRIHPWFGWSVEVWMIFTTLAGRSLARAAQEVERPLRENDLAES RIKLSWIVGRDTSQLQPAQINRGVVETVAENTVDGIIAPLFFLFLGGAPLAMAYKAVNTL DSMVGYKHEKYRAIGMVSARMDDVANYLPARLSWLLLGIAAGLCRLSGWRALRIGWRDRY NHSSPNCAWSEACVAGALGIQLGGPNNYFGERVDKPWIGDAQRDISVDDISRTIRLMWVA STLALALFIAARCGLSGVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM151B (NM_205548) Human Over-expression Lysate
LC404256 20 µg

FAM151B (NM_205548) Human Over-expression Lysate

Sign In for Pricing
View Details
HSP40, YDJ1 Antibody
SMC-166D 100 µg

HSP40, YDJ1 Antibody

Sign In for Pricing
View Details
SOCS6 (NM_004232) Human Over-expression Lysate
LC401359 20 µg

SOCS6 (NM_004232) Human Over-expression Lysate

Sign In for Pricing
View Details
WWP1 Antibody
KC-1580-01 50 μL

WWP1 Antibody

Sign In for Pricing
View Details
WWP1 Antibody
KC-1580-02 100 µL

WWP1 Antibody

Sign In for Pricing
View Details
WWP1 Antibody
KC-1580-03 1 mL

WWP1 Antibody

Sign In for Pricing
View Details