Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi B Cobalamin biosynthesis protein CbiB (cbiB)

This Recombinant Salmonella paratyphi B Cobalamin biosynthesis protein CbiB (cbiB) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CbiB

UniProt

A9MT86

Expression Region

1-319

Origin

Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTILAWCIAWVLDFIIGDPQHWPHPVRWIGRLITFVQRIVRRYCPGDKALRIGGGVMWVV VVGATWGVAWGVLALAQRIHPWFGWSVEVWMIFTTLAGRSLARAAQEVERPLRENDLAES RIKLSWIVGRDTSQLQPAQINRGVVETVAENTVDGIIAPLFFLFLGGAPLAMAYKAVNTL DSMVGYKHEKYRAIGMVSARMDDVANYLPARLSWLLLGIAAGLCRLSGWRALRIGWRDRY NHSSPNCAWSEACVAGALGIQLGGPNNYFGERVDKPWIGDAQRDISVDDISRTIRLMWVA STLALALFIAARCGLSGVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e Mouse Monoclonal Antibody (SK7), CF®700 Conjugate - Biotium Choice
P002-700-125 1x 125 µL

CD3e Mouse Monoclonal Antibody (SK7), CF®700 Conjugate - Biotium Choice

Sign In for Pricing
View Details
Anks1 Mouse Gene Knockout Kit (CRISPR)
KN501306 1 Kit

Anks1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KDM3A Antibody
KC-7465-01 50 μL

KDM3A Antibody

Sign In for Pricing
View Details
KDM3A Antibody
KC-7465-02 100 µL

KDM3A Antibody

Sign In for Pricing
View Details
KDM3A Antibody
KC-7465-03 1 mL

KDM3A Antibody

Sign In for Pricing
View Details
(R)-2-Aminobutyramide Hydrochloride
TRC-A602840-5G 5 g

(R)-2-Aminobutyramide Hydrochloride

Sign In for Pricing
View Details