Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Germ cell-specific gene 1 protein (Gsg1)

This Recombinant Rat Germ cell-specific gene 1 protein (Gsg1) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Germ cell-specific gene 1 protein

UniProt

Q6AYL2

Expression Region

1-325

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFQKGPSDQRTFVSAILNMLSLGLSTASLLSSEWFVGAQKVPKPLCGQSLAAKCFDMPM SLDGGITNASAQEVVQYTWEAGDDRFSFLTFRSGMWLSCEETVEEPGEKCRRFIELTPPA QREVLWLSLGAQTAYIGLQFISFLLLLTDLLLTSNPGCGLKLSAFAAVSLVLSGLLGMVA HMLYLQVFQATANLGPEDWRPHSWNYGWAFYTAWVSFTCCMVSAVTTFNTYTRMVLEFKC RHGTSFNTNPSCRAQHHRCFLPPLTCAVHAGEPSTSCHQHPSHPIRSVSESIDLYSAAAL QDKKFQQENSQELKEATESSVEEQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein FAM48A (FAM48A) Rat ELISA Kit
G3128 96 Tests

Protein FAM48A (FAM48A) Rat ELISA Kit

Sign In for Pricing
View Details
BANF1 (NM_003860) Human Mass Spec Standard
PH303270 10 µg

BANF1 (NM_003860) Human Mass Spec Standard

Sign In for Pricing
View Details
Anti-Fos B/FOSB Antibody Picoband®, FITC Conjugate
PA1478-FITC 100 µg/Vial

Anti-Fos B/FOSB Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Recombinant Albumin (ALB)
TRV-0014600-01 10 µg

Recombinant Albumin (ALB)

Sign In for Pricing
View Details
Recombinant Albumin (ALB)
TRV-0014600-02 50 µg

Recombinant Albumin (ALB)

Sign In for Pricing
View Details
Recombinant Albumin (ALB)
TRV-0014600-03 100 µg

Recombinant Albumin (ALB)

Sign In for Pricing
View Details