Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Germ cell-specific gene 1 protein (Gsg1)

This Recombinant Rat Germ cell-specific gene 1 protein (Gsg1) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Germ cell-specific gene 1 protein

UniProt

Q6AYL2

Expression Region

1-325

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFQKGPSDQRTFVSAILNMLSLGLSTASLLSSEWFVGAQKVPKPLCGQSLAAKCFDMPM SLDGGITNASAQEVVQYTWEAGDDRFSFLTFRSGMWLSCEETVEEPGEKCRRFIELTPPA QREVLWLSLGAQTAYIGLQFISFLLLLTDLLLTSNPGCGLKLSAFAAVSLVLSGLLGMVA HMLYLQVFQATANLGPEDWRPHSWNYGWAFYTAWVSFTCCMVSAVTTFNTYTRMVLEFKC RHGTSFNTNPSCRAQHHRCFLPPLTCAVHAGEPSTSCHQHPSHPIRSVSESIDLYSAAAL QDKKFQQENSQELKEATESSVEEQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine von Willebrand factor type A, EGF And Pentraxin Domain containing protein 1 ELISA Kit
GTR10362701 96 Well

Canine von Willebrand factor type A, EGF And Pentraxin Domain containing protein 1 ELISA Kit

Sign In for Pricing
View Details
Esm1 Mouse qPCR Template Standard (NM_023612)
MK203260 1 Kit

Esm1 Mouse qPCR Template Standard (NM_023612)

Sign In for Pricing
View Details
TolB Antibody
orb833324 2 mg

TolB Antibody

Sign In for Pricing
View Details
HRH3 3'UTR Luciferase Stable Cell Line
TU010163 1.0 mL

HRH3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-Caspase-3 antibody
STJ119192 100 µl

Anti-Caspase-3 antibody

Sign In for Pricing
View Details
Hsa-miR-495-5p agomir
HY-R01473A-01 5 nmol

Hsa-miR-495-5p agomir

Sign In for Pricing
View Details