Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Germ cell-specific gene 1 protein (Gsg1)

This Recombinant Rat Germ cell-specific gene 1 protein (Gsg1) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Germ cell-specific gene 1 protein

UniProt

Q6AYL2

Expression Region

1-325

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFQKGPSDQRTFVSAILNMLSLGLSTASLLSSEWFVGAQKVPKPLCGQSLAAKCFDMPM SLDGGITNASAQEVVQYTWEAGDDRFSFLTFRSGMWLSCEETVEEPGEKCRRFIELTPPA QREVLWLSLGAQTAYIGLQFISFLLLLTDLLLTSNPGCGLKLSAFAAVSLVLSGLLGMVA HMLYLQVFQATANLGPEDWRPHSWNYGWAFYTAWVSFTCCMVSAVTTFNTYTRMVLEFKC RHGTSFNTNPSCRAQHHRCFLPPLTCAVHAGEPSTSCHQHPSHPIRSVSESIDLYSAAAL QDKKFQQENSQELKEATESSVEEQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF HDR Plasmid (m2)
sc-423665-HDR-2 20 µg

VEGF HDR Plasmid (m2)

Sign In for Pricing
View Details
Srpa-72 Antibody
orb802416 2 mg

Srpa-72 Antibody

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Zuotin Related Factor 1 (ZRF1)
MBS2067119-01 0.1 mL

FITC-Linked Polyclonal Antibody to Zuotin Related Factor 1 (ZRF1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Zuotin Related Factor 1 (ZRF1)
MBS2067119-02 0.2 mL

FITC-Linked Polyclonal Antibody to Zuotin Related Factor 1 (ZRF1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Zuotin Related Factor 1 (ZRF1)
MBS2067119-03 0.5 mL

FITC-Linked Polyclonal Antibody to Zuotin Related Factor 1 (ZRF1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Zuotin Related Factor 1 (ZRF1)
MBS2067119-04 1 mL

FITC-Linked Polyclonal Antibody to Zuotin Related Factor 1 (ZRF1)

Sign In for Pricing
View Details