Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pisum sativum Triose phosphate/phosphate translocator, chloroplastic

This Recombinant Pisum sativum Triose phosphate/phosphate translocator, chloroplastic spans the amino acid sequence from region 73-402.

Product Specifications

Product Name Alternative

Triose phosphate/phosphate translocator, chloroplastic, cTPT, E30, p36

UniProt

P21727

Expression Region

73-402

Origin

Pisum sativum (Garden pea)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATAGGNDSAGEEKVAPVGFFSRYPALTTGFFFFTWYFLNVIFNILNKKIYNYFPYPYFVS VIHLAVGVVYCLVSWTVGLPKRAPIDGNLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTH TVKALEPFFNAAASQFILGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNI SFTYRSIYSKKAMTDMDSTNIYAYISIIALIVCIPPALIIEGPTLLKTGFNDAIAKVGLV KFVSDLFWVGMFYHLYNQVATNTLERVAPLTHAVGNVLKRVFVIGFSIIIFGNKISTQTG IGTGIAIAGVALYSFIKAQIEEEKRQAKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICAM2 (NM_001099789) Human Recombinant Protein
TP312775L 1 mg

ICAM2 (NM_001099789) Human Recombinant Protein

Sign In for Pricing
View Details
EIF4B Antibody
KC-2152-01 50 μL

EIF4B Antibody

Sign In for Pricing
View Details
EIF4B Antibody
KC-2152-02 100 µL

EIF4B Antibody

Sign In for Pricing
View Details
EIF4B Antibody
KC-2152-03 1 mL

EIF4B Antibody

Sign In for Pricing
View Details
Phosphoric Acid Silver Salt
TRC-P359210-25G 25 g

Phosphoric Acid Silver Salt

Sign In for Pricing
View Details
Pregnancy zone protein (PZP) (NM_002864) Human Recombinant Protein
TP315526L 1 mg

Pregnancy zone protein (PZP) (NM_002864) Human Recombinant Protein

Sign In for Pricing
View Details