Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gap junction alpha-4 protein (Gja4)

This Recombinant Rat Gap junction alpha-4 protein (Gja4) spans the amino acid sequence from region 2-333.

Product Specifications

Product Name Alternative

Gap junction alpha-4 protein, Connexin-37, Cx37

UniProt

Q03190

Expression Region

2-333

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGC TNVCYDQAFPISHIRYWVLQFLFVSTPTLIYLGHVIYLSRREERLRQKEGELRALPSKDP HVERALAAIEHQMAKISVAEDGRLRIRGALMGTYVISVLCKSVLEAGFLYGQWRLYGWTM EPVFVCQRAPCPHVVDCYVSRPTEKTIFIIFMLVVGVISLVLNLLELVHLLCRCVSREIK ARRDHDTRPAQGSASDPYPEQVFFYLPMGEGPSSPPCPTYNGLSSTEQNWANLTTEERLT STRPPPFVNAAPQGGQKSSSRPNSSASKKQYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTLRP (GHRL) (NM_016362) Human Over-expression Lysate
LC402547 20 µg

MTLRP (GHRL) (NM_016362) Human Over-expression Lysate

Sign In for Pricing
View Details
TCTN1 (NM_001082537) Human Over-expression Lysate
LY421188 100 µg

TCTN1 (NM_001082537) Human Over-expression Lysate

Sign In for Pricing
View Details
Argininosuccinate Lyase (ASL) (NM_000048) Human Over-expression Lysate
LY424953 100 µg

Argininosuccinate Lyase (ASL) (NM_000048) Human Over-expression Lysate

Sign In for Pricing
View Details
Actinomycin D
#40038 1x 10 mg

Actinomycin D

Sign In for Pricing
View Details
PIG3 (TP53I3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E3]
TA503590BM 100 µL

PIG3 (TP53I3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E3]

Sign In for Pricing
View Details
TMEFF2 (NM_016192) Human Over-expression Lysate
LY402517 100 µg

TMEFF2 (NM_016192) Human Over-expression Lysate

Sign In for Pricing
View Details