Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gap junction alpha-4 protein (Gja4)

This Recombinant Rat Gap junction alpha-4 protein (Gja4) spans the amino acid sequence from region 2-333.

Product Specifications

Product Name Alternative

Gap junction alpha-4 protein, Connexin-37, Cx37

UniProt

Q03190

Expression Region

2-333

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGC TNVCYDQAFPISHIRYWVLQFLFVSTPTLIYLGHVIYLSRREERLRQKEGELRALPSKDP HVERALAAIEHQMAKISVAEDGRLRIRGALMGTYVISVLCKSVLEAGFLYGQWRLYGWTM EPVFVCQRAPCPHVVDCYVSRPTEKTIFIIFMLVVGVISLVLNLLELVHLLCRCVSREIK ARRDHDTRPAQGSASDPYPEQVFFYLPMGEGPSSPPCPTYNGLSSTEQNWANLTTEERLT STRPPPFVNAAPQGGQKSSSRPNSSASKKQYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS500718 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
MAGE A1 (MA454), 0.2mg/mL
BNUB0008-500 1x 500 µL

MAGE A1 (MA454), 0.2mg/mL

Sign In for Pricing
View Details
Nogo Receptor (RTN4R) (NM_023004) Human Recombinant Protein
TP720491M 50 µg

Nogo Receptor (RTN4R) (NM_023004) Human Recombinant Protein

Sign In for Pricing
View Details
Vertical Autoclave BAVT-2903
BAVT-2903 1 Unit

Vertical Autoclave BAVT-2903

Sign In for Pricing
View Details
LCN9 (NM_001001676) Human Over-expression Lysate
LY424204 100 µg

LCN9 (NM_001001676) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), Biotin conjugate, 0.1mg/mL
BNCB2958-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details