Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dual oxidase maturation factor 1 (DUOXA1)

This Recombinant Human Dual oxidase maturation factor 1 (DUOXA1) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Dual oxidase maturation factor 1, Dual oxidase activator 1, Numb-interacting protein

UniProt

Q1HG43

Expression Region

1-343

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTS LFIGAAILAVNFSSEWSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQL NETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYT SAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGA SVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEG GLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ɑ-Butyric Acid NHS Ester-ω-Pyridyldithiopropanamido PEG
135000-44-35.500MG 500 mg

Ɑ-Butyric Acid NHS Ester-ω-Pyridyldithiopropanamido PEG

Sign In for Pricing
View Details
LCK Human Gene Knockout Kit (CRISPR)
KN419375 1 Kit

LCK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS625519 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Azido PEG
1220000-5.500MG 500 mg

Ɑ-Methoxy-ω-Azido PEG

Sign In for Pricing
View Details
Mouse Gdi2 activation kit by CRISPRa
GA201586 1 Kit

Mouse Gdi2 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lymph node
CB536230 1 Block

Frozen Tissue Blocks, Lymph node

Sign In for Pricing
View Details