Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dual oxidase maturation factor 1 (DUOXA1)

This Recombinant Human Dual oxidase maturation factor 1 (DUOXA1) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Dual oxidase maturation factor 1, Dual oxidase activator 1, Numb-interacting protein

UniProt

Q1HG43

Expression Region

1-343

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTS LFIGAAILAVNFSSEWSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQL NETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYT SAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGA SVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEG GLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPA17 Antibody
KC-22669-01 50 μL

SPA17 Antibody

Sign In for Pricing
View Details
SPA17 Antibody
KC-22669-02 100 µL

SPA17 Antibody

Sign In for Pricing
View Details
SPA17 Antibody
KC-22669-03 1 mL

SPA17 Antibody

Sign In for Pricing
View Details
SCHIP1 (NM_001197107) Human Over-expression Lysate
LC434259 20 µg

SCHIP1 (NM_001197107) Human Over-expression Lysate

Sign In for Pricing
View Details
TPPP2 (NM_173846) Human Recombinant Protein
TP307939L 1 mg

TPPP2 (NM_173846) Human Recombinant Protein

Sign In for Pricing
View Details
Car11 Mouse Gene Knockout Kit (CRISPR)
KN502527 1 Kit

Car11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details