Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dual oxidase maturation factor 1 (DUOXA1)

This Recombinant Human Dual oxidase maturation factor 1 (DUOXA1) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Dual oxidase maturation factor 1, Dual oxidase activator 1, Numb-interacting protein

UniProt

Q1HG43

Expression Region

1-343

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTS LFIGAAILAVNFSSEWSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQL NETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYT SAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGA SVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEG GLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neuroplastin (NPTN) ELISA Kit
RD-NPTN-Hu-01 96 Tests

Human Neuroplastin (NPTN) ELISA Kit

Sign In for Pricing
View Details
Human Neuroplastin (NPTN) ELISA Kit
RD-NPTN-Hu-02 48 Tests

Human Neuroplastin (NPTN) ELISA Kit

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Respiratory Syncytial Virus,  5nm
GM-46-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Respiratory Syncytial Virus, 5nm

Sign In for Pricing
View Details
TROP2 Recombinant Mouse monoclonal Antibody
HA610138 100 µg

TROP2 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Anti-A Helix pomatia Lectin (Edible Snail) -HPA-
B-3601-2 2 mL

Anti-A Helix pomatia Lectin (Edible Snail) -HPA-

Sign In for Pricing
View Details
Mouse/Rat Prealbumin Recombinant Rabbit monoclonal Antibody
HA725128 100 µL

Mouse/Rat Prealbumin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details