Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein (psbA1)

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein (psbA1) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q7TTH6

Expression Region

1-343

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTIRSGRLSGWESFCNWVTSTNNRIYVGWFGVLMVPTLLAAAICFTIAFIAAPPVDID GIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAASVDEWLYNGGPYQLVVFHFLI GICCWLGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLIYPVGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMIGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVICIWITSLGISTMAFNLNGFN FNQSVLDAQGRVVPTWADVLNRSNLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

gankyrin Double Nickase Plasmid (h2)
sc-402164-NIC-2 20 µg

gankyrin Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
PRR11 Rabbit Polyclonal Antibody
orb3129105 100 µg

PRR11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCAG-3xFLAG-OR5AK2 (human) -EGFP-StrepII
BZ58302 1 Vial

PCAG-3xFLAG-OR5AK2 (human) -EGFP-StrepII

Sign In for Pricing
View Details
Human SLC35G1 knockout cell line
ABC-KH14077 1 Vial

Human SLC35G1 knockout cell line

Sign In for Pricing
View Details
Anti- Alpha-2 C-adrenergic receptor (Alpha 2c) Antibody
GWB-CF3341 0.1 mg

Anti- Alpha-2 C-adrenergic receptor (Alpha 2c) Antibody

Sign In for Pricing
View Details
Gtf2h1-set siRNA/shRNA/RNAi Lentivector (Mouse)
22792094 4x 500 ng

Gtf2h1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details