Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem Q (B) protein (psbA1)

This Recombinant Prochlorococcus marinus Photosystem Q (B) protein (psbA1) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q7TTH6

Expression Region

1-343

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTIRSGRLSGWESFCNWVTSTNNRIYVGWFGVLMVPTLLAAAICFTIAFIAAPPVDID GIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAASVDEWLYNGGPYQLVVFHFLI GICCWLGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLIYPVGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMIGVAGMFGGSLFSAMHGSLVTSSLIRETTETESQNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVICIWITSLGISTMAFNLNGFN FNQSVLDAQGRVVPTWADVLNRSNLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gallus, gizzard t.s. showing thick cornified layer
Av127d 7.6 x 2.6 cm

Gallus, gizzard t.s. showing thick cornified layer

Sign In for Pricing
View Details
ANKRD18B (NM_001244752) Human Tagged ORF Clone
RG239880 10 µg

ANKRD18B (NM_001244752) Human Tagged ORF Clone

Sign In for Pricing
View Details
Flagellin, B. substilis (TLR5 Ligand)
208900 50 µg

Flagellin, B. substilis (TLR5 Ligand)

Sign In for Pricing
View Details
Synaptotagmin Rabbit Polyclonal Antibody
E28PT4485 100 µL

Synaptotagmin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phosphotyrosine Antibody Peroxidase Conjugated
orb420457 100 µg

Phosphotyrosine Antibody Peroxidase Conjugated

Sign In for Pricing
View Details
Human TOR1AIP2 (Torsin-1A-interacting protein 2) ELISA Kit
EH13117 96 Tests

Human TOR1AIP2 (Torsin-1A-interacting protein 2) ELISA Kit

Sign In for Pricing
View Details