Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta gronovii Photosystem Q (B) protein

This Recombinant Cuscuta gronovii Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A7M8Y6

Expression Region

1-344

Origin

Cuscuta gronovii (Common dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVVLDRRKSENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFLIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASIAEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAIAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTESESANKGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISTMAFNLNGF NFNQSVVDSKGHVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (A53-B/A2.26), 0.2mg/mL
BNUB0020-500 1x 500 µL

Cytokeratin 19 (A53-B/A2.26), 0.2mg/mL

Sign In for Pricing
View Details
RNF5 (NM_006913) Human Over-expression Lysate
LC402057 20 µg

RNF5 (NM_006913) Human Over-expression Lysate

Sign In for Pricing
View Details
MUC5AC Polyclonal Antibody
E-AB-40276-01 25 µL

MUC5AC Polyclonal Antibody

Sign In for Pricing
View Details
MUC5AC Polyclonal Antibody
E-AB-40276-02 100 µL

MUC5AC Polyclonal Antibody

Sign In for Pricing
View Details
BC005624 Mouse Gene Knockout Kit (CRISPR)
KN502010 1 Kit

BC005624 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BEX2 Mouse Monoclonal Antibody [Clone ID: OTI1H3]
CF811155 100 µg

BEX2 Mouse Monoclonal Antibody [Clone ID: OTI1H3]

Sign In for Pricing
View Details