Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta gronovii Photosystem Q (B) protein

This Recombinant Cuscuta gronovii Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A7M8Y6

Expression Region

1-344

Origin

Cuscuta gronovii (Common dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVVLDRRKSENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFLIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASIAEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAIAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTESESANKGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISTMAFNLNGF NFNQSVVDSKGHVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+/-)-beta-Hydrastine
TRC-H675690-25MG 25 mg

(+/-)-beta-Hydrastine

Sign In for Pricing
View Details
AATOM™ 532 NHS ester
2822-AAT 1 mg

AATOM™ 532 NHS ester

Sign In for Pricing
View Details
ARF6 (NM_001663) Human Over-expression Lysate
LY400629 100 µg

ARF6 (NM_001663) Human Over-expression Lysate

Sign In for Pricing
View Details
R-(+)-Etomoxir Carboxylate, Potassium Salt
TRC-E933508-5MG 5 mg

R-(+)-Etomoxir Carboxylate, Potassium Salt

Sign In for Pricing
View Details
G protein coupled receptor 30 (GPER1) (NM_001039966) Human Over-expression Lysate
LY421866 100 µg

G protein coupled receptor 30 (GPER1) (NM_001039966) Human Over-expression Lysate

Sign In for Pricing
View Details
2,2'-Dithiobisbenzoic Acid
TRC-D493990-1G 1 g

2,2'-Dithiobisbenzoic Acid

Sign In for Pricing
View Details