Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein (psbA1)

This Recombinant Photosystem Q (B) protein (psbA1) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q0P3J1

Expression Region

1-344

Origin

Ostreococcus tauri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATLERRANATVWGRFCSWITSTENRLYIGWFGVLMIPTLLTATSVFIVAFIAAPPVDI DGIREPVSGSLMYGNNIISGAVIPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLIVCHFF IGICSYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAIWPVMGIWFTALGISTMAFNLNGF NFNQSVVDSNGRVINTWADIVNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PDGFD Protein, N-His
orb2966997-01 50 µg

Recombinant Human PDGFD Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PDGFD Protein, N-His
orb2966997-02 100 µg

Recombinant Human PDGFD Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PDGFD Protein, N-His
orb2966997-03 1 mg

Recombinant Human PDGFD Protein, N-His

Sign In for Pricing
View Details
IRGM, ID (Immunity-related GTPase Family M Protein, Immunity-related GTPase Family M Protein 1, Interferon-inducible Protein 1, LPS-stimulated RAW 264.7 Macrophage Protein 47 Homolog, LRG-47, IFI1, IRGM1, LRG47)
214960 100 µg

IRGM, ID (Immunity-related GTPase Family M Protein, Immunity-related GTPase Family M Protein 1, Interferon-inducible Protein 1, LPS-stimulated RAW 264.7 Macrophage Protein 47 Homolog, LRG-47, IFI1, IRGM1, LRG47)

Sign In for Pricing
View Details
Rabbit Polyclonal IL-12 p70/IL-12A Antibody [Alexa Fluor 350]
NBP2-98685AF350 0.1 mL

Rabbit Polyclonal IL-12 p70/IL-12A Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
IL9RP1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1077702 1.0 µg DNA

IL9RP1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details