Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein

This Recombinant Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P15191

Expression Region

1-344

Origin

Prochlorothrix hollandica

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTALRQRESANAWEQFCQWIASTENRLYVGWFGVIMIPTLLTATICFIIAFIAAPPVDI DGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASMDEWLYNGGPYQLVVFHFL IGIFCYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLIYPLGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETSENESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVVGIWFTSLGISTMAFNLNGF NFNQSVMDSQGRVISTWADILNRANLGFEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G5]
TA500599AM 100 µL

Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G5]

Sign In for Pricing
View Details
Purified Anti-Human CD74 Antibody[LN2]
E-AB-F1072A-01 25 µg

Purified Anti-Human CD74 Antibody[LN2]

Sign In for Pricing
View Details
Purified Anti-Human CD74 Antibody[LN2]
E-AB-F1072A-02 100 µg

Purified Anti-Human CD74 Antibody[LN2]

Sign In for Pricing
View Details
Galectin 7 Recombinant Rabbit Monoclonal Antibody [JB38-11]
ET7107-54 100 µL

Galectin 7 Recombinant Rabbit Monoclonal Antibody [JB38-11]

Sign In for Pricing
View Details
CEACAM16 Mouse Monoclonal Antibody [Clone ID: SU-9D5]
AM32984PU-N 100 µg

CEACAM16 Mouse Monoclonal Antibody [Clone ID: SU-9D5]

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF594 conjugate, 0.1mg/mL
BNC941670-500 1x 500 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details