Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 47 (CCDC47)

This Recombinant Human Coiled-coil domain-containing protein 47 (CCDC47) spans the amino acid sequence from region 21-483.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 47

UniProt

Q96A33

Expression Region

21-483

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVELEGQDENQEG DFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSKNKDPITIVDVPAHLQNSWESYYLEI LMVTGLLAYIMNYIIGKNKNSRLAQAWFNTHRELLESNFTLVGDDGTNKEATSTGKLNQE NEHIYNLWCSGRVCCEGMLIQLRFLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYV FAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHF LTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALL PLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAE KERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKVKAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP6 (NM_001946) Human Over-expression Lysate
LC419629 20 µg

DUSP6 (NM_001946) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytochrome P450 3A5 (CYP3A5) (NM_000777) Human Recombinant Protein
TP307432 20 µg

Cytochrome P450 3A5 (CYP3A5) (NM_000777) Human Recombinant Protein

Sign In for Pricing
View Details
Monomethyl Lys4 Histone H3 Polyclonal Antibody
A008-50MG 50 mg

Monomethyl Lys4 Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2421), CF568 conjugate, 0.1mg/mL
BNC682421-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2421), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB523219 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
Cytokeratin 8/18 (B22.1 + B23.1), CF740 conjugate, 0.1mg/mL
BNC741221-500 1x 500 µL

Cytokeratin 8/18 (B22.1 + B23.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details