Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtI (mdtI)

This Recombinant Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

Q0WF87

Expression Region

1-109

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQLEFYPIAFLILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVKGIE LSVAYALWGGFGIAATVAAGWILFNQRLNYKGWIGLILLLAGMVMIKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Cytokeratin 9 (CK9)
TRV-0033990-01 20 µL

Monoclonal Antibody to Cytokeratin 9 (CK9)

Sign In for Pricing
View Details
Monoclonal Antibody to Cytokeratin 9 (CK9)
TRV-0033990-02 100 µL

Monoclonal Antibody to Cytokeratin 9 (CK9)

Sign In for Pricing
View Details
Monoclonal Antibody to Cytokeratin 9 (CK9)
TRV-0033990-03 200 µL

Monoclonal Antibody to Cytokeratin 9 (CK9)

Sign In for Pricing
View Details
Monoclonal Antibody to Cytokeratin 9 (CK9)
TRV-0033990-04 1 mL

Monoclonal Antibody to Cytokeratin 9 (CK9)

Sign In for Pricing
View Details
Compound NP-022687
MBS5793503 Inquire

Compound NP-022687

Sign In for Pricing
View Details
UMP-CMP Kinase Polyclonal Antibody
orb311064-01 50 μL

UMP-CMP Kinase Polyclonal Antibody

Sign In for Pricing
View Details