Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtI (mdtI)

This Recombinant Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

Q0WF87

Expression Region

1-109

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQLEFYPIAFLILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVKGIE LSVAYALWGGFGIAATVAAGWILFNQRLNYKGWIGLILLLAGMVMIKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-DAAM1 Antibody
DL95366A-01 50 µL

Rabbit anti-DAAM1 Antibody

Sign In for Pricing
View Details
Rabbit anti-DAAM1 Antibody
DL95366A-02 100 µL

Rabbit anti-DAAM1 Antibody

Sign In for Pricing
View Details
Human OR2Z1 Pre-designed siRNA Set A
SI011243A 1 Each

Human OR2Z1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SLITRK2 Rabbit Polyclonal Antibody
TA361018 100 µL

SLITRK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOC314140 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6363306 1.0 µg DNA

LOC314140 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans smg-9 Polyclonal Antibody
MBS9015283 Inquire

Rabbit anti-Caenorhabditis elegans smg-9 Polyclonal Antibody

Sign In for Pricing
View Details