Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q49W90

Expression Region

1-142

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQKNNLIFQYSAVVIFFLIVMFGLSLFLAGHYTPGGGFVGGLLLSSALVIITVAFDIK TMRKIFPWDFKILIGIGLLFCLATPMASWFYNKNFFTHTPFEIPLGILPPMEMHTATFFD LGVMCAVVGTVMTIILSIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-hsa-miR-4310 Vector
mh30812 500 ng

LentimiRa-Off-hsa-miR-4310 Vector

Sign In for Pricing
View Details
Canine Interleukin 12 (IL12) ELISA Kit
RD-IL12-c-96Tests 96 Tests

Canine Interleukin 12 (IL12) ELISA Kit

Sign In for Pricing
View Details
MYEF2 ELISA Kit (Human) (OKWB00199)
OKWB00199 96 Well

MYEF2 ELISA Kit (Human) (OKWB00199)

Sign In for Pricing
View Details
ZNF133 (Zinc Finger Protein 133, Zinc Finger Protein 150, ZNF150, pHZ-13, pHZ-66)
135599 100 µg

ZNF133 (Zinc Finger Protein 133, Zinc Finger Protein 150, ZNF150, pHZ-13, pHZ-66)

Sign In for Pricing
View Details
Trihexyltetradecylphosphonium decanoate
IN-0008-TG-0050 50 g

Trihexyltetradecylphosphonium decanoate

Sign In for Pricing
View Details
TAO1 Conjugated Antibody
orb1612854 100 µL

TAO1 Conjugated Antibody

Sign In for Pricing
View Details