Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Na (+) /H (+) antiporter subunit B1 (mnhB1)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Na (+) /H (+) antiporter subunit B1 (mnhB1) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

Q49W90

Expression Region

1-142

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQKNNLIFQYSAVVIFFLIVMFGLSLFLAGHYTPGGGFVGGLLLSSALVIITVAFDIK TMRKIFPWDFKILIGIGLLFCLATPMASWFYNKNFFTHTPFEIPLGILPPMEMHTATFFD LGVMCAVVGTVMTIILSIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Haptoglobin (Hpt) Polyclonal Antibody
CAU27052-01 100 µL

Haptoglobin (Hpt) Polyclonal Antibody

Sign In for Pricing
View Details
Haptoglobin (Hpt) Polyclonal Antibody
CAU27052-02 200 µL

Haptoglobin (Hpt) Polyclonal Antibody

Sign In for Pricing
View Details
Haptoglobin (Hpt) Polyclonal Antibody
CAU27052-03 1 mL

Haptoglobin (Hpt) Polyclonal Antibody

Sign In for Pricing
View Details
Pym1 (NM_001108986) Rat Tagged Lenti ORF Clone
RR214430L3 10 µg

Pym1 (NM_001108986) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
POLDIP3 Human Pre-designed siRNA Set A
HY-RS10824 1 Set

POLDIP3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
5-Bromogramine
265909-01 500 mg

5-Bromogramine

Sign In for Pricing
View Details