Recombinant Mouse Vitamin K epoxide reductase complex subunit 1-like protein 1 (Vkorc1l1)
This Recombinant Mouse Vitamin K epoxide reductase complex subunit 1-like protein 1 (Vkorc1l1) spans the amino acid sequence from region 1-176.
Product Specifications
Product Name Alternative
Vitamin K epoxide reductase complex subunit 1-like protein 1, VKORC1-like protein 1
UniProt
Q6TEK5
Expression Region
1-176
Origin
Mus musculus (Mouse)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSA ALASRWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALVLMTSSIVS VVGSLYLAYILYFVLKEFCIICVTTYVLNFLLLIINYKRLVYLNEAWKRQLQPKED
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC801037-100 1x 100 µL
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040857-100 1x 100 µL
WT1 (Wilm's Tumor 1) (WT1/857), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681389-100 1x 100 µL
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740634-500 1x 500 µL
CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details