Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6 (petB)

This Recombinant Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q9MUV3

Expression Region

1-215

Origin

Mesostigma viride

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKVYDWFNDRLEIQGIADDITSKYVPPHVNIFYCIGGITFTCFIMQVASGFAMTFYYRP TVTEAFASVQYIMTDVNFGWLIRSIHKWSASMMVLTMILHVFRVYLTGGFKKPRELTWVT GVILAVCTVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGAPLVELLRGGVGVGQSTL TRFYSLHTFVLPLLTAVFMLAHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mier1 Mouse shRNA Plasmid (Locus ID 71148)
TL517087 1 Kit

Mier1 Mouse shRNA Plasmid (Locus ID 71148)

Sign In for Pricing
View Details
Rad51D Rabbit pAb
A7534-01 100 μL

Rad51D Rabbit pAb

Sign In for Pricing
View Details
Rad51D Rabbit pAb
A7534-02 20 µL

Rad51D Rabbit pAb

Sign In for Pricing
View Details
Rad51D Rabbit pAb
A7534-03 500 μL

Rad51D Rabbit pAb

Sign In for Pricing
View Details
Rad51D Rabbit pAb
A7534-04 1000 μL

Rad51D Rabbit pAb

Sign In for Pricing
View Details
Progesterone Receptor
HAR323-6ml 6 mL

Progesterone Receptor

Sign In for Pricing
View Details