Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6 (petB)

This Recombinant Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q9MUV3

Expression Region

1-215

Origin

Mesostigma viride

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKVYDWFNDRLEIQGIADDITSKYVPPHVNIFYCIGGITFTCFIMQVASGFAMTFYYRP TVTEAFASVQYIMTDVNFGWLIRSIHKWSASMMVLTMILHVFRVYLTGGFKKPRELTWVT GVILAVCTVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGAPLVELLRGGVGVGQSTL TRFYSLHTFVLPLLTAVFMLAHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF1AN antibody
FNab03860 100 µg

HIF1AN antibody

Sign In for Pricing
View Details
Mouse IL4R shRNA Plasmid
abx971038-01 150 µg

Mouse IL4R shRNA Plasmid

Sign In for Pricing
View Details
Mouse IL4R shRNA Plasmid
abx971038-02 300 µg

Mouse IL4R shRNA Plasmid

Sign In for Pricing
View Details
Vmn2r37 (NM_009489) Mouse Tagged Lenti ORF Clone
MR214101L4 10 µg

Vmn2r37 (NM_009489) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ATP5E Protein Vector (Mouse) (pPM-C-His)
PV157325 500 ng

ATP5E Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
SAR1B Rabbit Polyclonal Antibody (Biotin)
orb2103760 100 µL

SAR1B Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details