Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Leukocyte surface antigen CD53 (Cd53)

This Recombinant Rat Leukocyte surface antigen CD53 (Cd53) spans the amino acid sequence from region 2-219.

Product Specifications

Product Name Alternative

Leukocyte surface antigen CD53, Cell surface glycoprotein CD53, Leukocyte antigen MRC OX-44, CD_antigen= CD53

UniProt

P24485

Expression Region

2-219

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GMSSLKLLKYVLFFFNFLFWVCGCCILGFGIHLLVQNTYGILFRNLPFLTLGNVLVIVGS IIMVVAFLGCMGSIKENKCLLMSFFVLLLLILLAEVTLAILLFVYEKKINTLVAEGLNDS IQHYHSDNSTRMAWDFIQSQLQCCGVNGSSDWISGPPSSCPSGADVQGCYKKGQAWFHSN FLYIGIVTICVCVIQVLGMSFALTLNCQIDKTSQALGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ataxin 3 (ATXN3) (NM_001127696) Human Over-expression Lysate
LC426854 20 µg

Ataxin 3 (ATXN3) (NM_001127696) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 6 (LHK6), CF594 conjugate, 0.1mg/mL
BNC940675-100 1x 100 µL

Cytokeratin 6 (LHK6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LRRC47 activation kit by CRISPRa
GA111515 1 Kit

Human LRRC47 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CCL23/MPIF-1 Protein (Trx Tag)
PDEH100606-01 20 µg

Recombinant Human CCL23/MPIF-1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CCL23/MPIF-1 Protein (Trx Tag)
PDEH100606-02 100 µg

Recombinant Human CCL23/MPIF-1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CCL23/MPIF-1 Protein (Trx Tag)
PDEH100606-03 500 µg

Recombinant Human CCL23/MPIF-1 Protein (Trx Tag)

Sign In for Pricing
View Details