Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Leukocyte surface antigen CD53 (Cd53)

This Recombinant Rat Leukocyte surface antigen CD53 (Cd53) spans the amino acid sequence from region 2-219.

Product Specifications

Product Name Alternative

Leukocyte surface antigen CD53, Cell surface glycoprotein CD53, Leukocyte antigen MRC OX-44, CD_antigen= CD53

UniProt

P24485

Expression Region

2-219

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GMSSLKLLKYVLFFFNFLFWVCGCCILGFGIHLLVQNTYGILFRNLPFLTLGNVLVIVGS IIMVVAFLGCMGSIKENKCLLMSFFVLLLLILLAEVTLAILLFVYEKKINTLVAEGLNDS IQHYHSDNSTRMAWDFIQSQLQCCGVNGSSDWISGPPSSCPSGADVQGCYKKGQAWFHSN FLYIGIVTICVCVIQVLGMSFALTLNCQIDKTSQALGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dystrophia myotonica protein kinase (DMPK) Human qPCR Primer Pair (NM_004409)
HP234717 200 Reactions

Dystrophia myotonica protein kinase (DMPK) Human qPCR Primer Pair (NM_004409)

Sign In for Pricing
View Details
CD45RO (190-2F2.5), 0.2mg/mL
BNUB1081-100 1x 100 µL

CD45RO (190-2F2.5), 0.2mg/mL

Sign In for Pricing
View Details
Carboxy Polystyrene
H12516008.5G 5 g

Carboxy Polystyrene

Sign In for Pricing
View Details
Calcipressin 3 (RCAN3) (NM_013441) Human Recombinant Protein
TP307755 20 µg

Calcipressin 3 (RCAN3) (NM_013441) Human Recombinant Protein

Sign In for Pricing
View Details
Multi-Well Plates
DP22VS-9-NS 50 Pack/Case

Multi-Well Plates

Sign In for Pricing
View Details
PRPK (TP53RK) Human Gene Knockout Kit (CRISPR)
KN209748RB 1 Kit

PRPK (TP53RK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details