Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis UPF0177 protein ybdJ (ybdJ)

This Recombinant Lactococcus lactis subsp. lactis UPF0177 protein ybdJ (ybdJ) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

UPF0177 protein ybdJ

UniProt

Q9CJ66

Expression Region

1-226

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIERIKKFLRTKFKPLLLLLVTVILYNGWTPHLGIFPPTFYDFAFNYYGFVDILTFLVII VIAYKNDAFKKIFDIFRPKNLLFILFFIVGGNIFIALAHHLYFQMTPALEAFPEHSIDLA NYFARTPFWTHSLDLFVIGPISEELIYREYLYRLFDKKCLACFVSVTMFAWVHTGFTYSF FLYLPISLVVTLAYHRRKAIGESIALHSSINLINTYLPNLLSFWVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM4B Rabbit Monoclonal Antibody
TA423689 100 µL

KDM4B Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Ibuprofen 2-Monoglyceride
TRC-I400140-25MG 25 mg

Ibuprofen 2-Monoglyceride

Sign In for Pricing
View Details
Oxybenzone-(phenyl-13C6)
TRC-O867301-5MG 5 mg

Oxybenzone-(phenyl-13C6)

Sign In for Pricing
View Details
Human H10 (H1F0) activation kit by CRISPRa
GA102043 1 Kit

Human H10 (H1F0) activation kit by CRISPRa

Sign In for Pricing
View Details
Ces1d Mouse Gene Knockout Kit (CRISPR)
KN503190 1 Kit

Ces1d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rel B (RELB) Human Gene Knockout Kit (CRISPR)
KN207006RB 1 Kit

Rel B (RELB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details