Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis UPF0177 protein ybdJ (ybdJ)

This Recombinant Lactococcus lactis subsp. lactis UPF0177 protein ybdJ (ybdJ) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

UPF0177 protein ybdJ

UniProt

Q9CJ66

Expression Region

1-226

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIERIKKFLRTKFKPLLLLLVTVILYNGWTPHLGIFPPTFYDFAFNYYGFVDILTFLVII VIAYKNDAFKKIFDIFRPKNLLFILFFIVGGNIFIALAHHLYFQMTPALEAFPEHSIDLA NYFARTPFWTHSLDLFVIGPISEELIYREYLYRLFDKKCLACFVSVTMFAWVHTGFTYSF FLYLPISLVVTLAYHRRKAIGESIALHSSINLINTYLPNLLSFWVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FDFT1 Rabbit Polyclonal Antibody
AP12195PU-N 400 µL

FDFT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SCGBL (SCGB2B2) activation kit by CRISPRa
GA117142 1 Kit

Human SCGBL (SCGB2B2) activation kit by CRISPRa

Sign In for Pricing
View Details
Cyclin D1 (CCND1) Rabbit Monoclonal Antibody
TA422444 100 µL

Cyclin D1 (CCND1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Racecadotril-d5
TRC-R070602-10MG 10 mg

Racecadotril-d5

Sign In for Pricing
View Details
FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), 0.2mg/mL
BNUB2225-100 1x 100 µL

FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), 0.2mg/mL

Sign In for Pricing
View Details
Human FBXL16 activation kit by CRISPRa
GA115556 1 Kit

Human FBXL16 activation kit by CRISPRa

Sign In for Pricing
View Details