Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Electron transport complex protein RnfE (rnfE)

This Recombinant Salmonella paratyphi A Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

Q5PIC6

Expression Region

1-230

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSTLR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP1 Rabbit pAb
MBS9143683-01 0.02 mL

CASP1 Rabbit pAb

Sign In for Pricing
View Details
CASP1 Rabbit pAb
MBS9143683-02 0.1 mL

CASP1 Rabbit pAb

Sign In for Pricing
View Details
CASP1 Rabbit pAb
MBS9143683-03 5x 0.1 mL

CASP1 Rabbit pAb

Sign In for Pricing
View Details
Cathelicidin   monoclonal antibody
MB10669 50ul

Cathelicidin monoclonal antibody

Sign In for Pricing
View Details
CDK18 Antibody
orb419615 100 µL

CDK18 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Apolipoprotein D Antibody (APOD/3414) [PerCP]
NBP3-08437PCP 0.1 mL

Mouse Monoclonal Apolipoprotein D Antibody (APOD/3414) [PerCP]

Sign In for Pricing
View Details