Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Dolichyldiphosphatase 1 (Dolpp1)

This Recombinant Mouse Dolichyldiphosphatase 1 (Dolpp1) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Dolichyldiphosphatase 1, EC= 3.6.1.43, Dolichyl pyrophosphate phosphatase 1, Protein 2-23

UniProt

Q9JMF7

Expression Region

1-238

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPIFVVVGFLTLIIFKRELHTI SFLGGLALNQGVNWLIKHVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYL RMHQTNNARFLDLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVFYGGVAGSLMAVAWF IITQEILTPLFPRIAAWPISEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHGDH (NM_006623) Human Recombinant Protein
E45H40070M5 20 µg

PHGDH (NM_006623) Human Recombinant Protein

Sign In for Pricing
View Details
Skp2 (phospho-Ser64) rabbit pAb
ES13090-01 50 µL

Skp2 (phospho-Ser64) rabbit pAb

Sign In for Pricing
View Details
Skp2 (phospho-Ser64) rabbit pAb
ES13090-02 100 µL

Skp2 (phospho-Ser64) rabbit pAb

Sign In for Pricing
View Details
PPP2R3A Antibody
OACA10479-100UG 100 µg

PPP2R3A Antibody

Sign In for Pricing
View Details
Human CRX Pre-designed siRNA Set A
SI003649A 1 Each

Human CRX Pre-designed siRNA Set A

Sign In for Pricing
View Details
GENLISA Human Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF-15 / TNFSF15) ELISA
KBH17135 1x 96 Well

GENLISA Human Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF-15 / TNFSF15) ELISA

Sign In for Pricing
View Details