Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2YUJ5

Expression Region

1-242

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM48 Antibody, Biotin conjugated
A61318-50UG 50 µg

TRIM48 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Gold Nanoparticle Conjugation Optimization Kit - Lateral Flow + QC Conjugation Test Kit
GO-LF-200-QC 1 Kit

Gold Nanoparticle Conjugation Optimization Kit - Lateral Flow + QC Conjugation Test Kit

Sign In for Pricing
View Details
TM6SF2 (NM_001001524) Human Tagged Lenti ORF Clone
RC214298L4 10 µg

TM6SF2 (NM_001001524) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Easypro Human Gdnf (Glial Cell Line Derived Neurotrophic Factor) ELISA Kit
FY-EH1868S 96 Well

Easypro Human Gdnf (Glial Cell Line Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Cas9 from Staphylococcus aureus, IgY prep, chicken
MBS555651-01 0.1 mL

Cas9 from Staphylococcus aureus, IgY prep, chicken

Sign In for Pricing
View Details
Cas9 from Staphylococcus aureus, IgY prep, chicken
MBS555651-02 5x 0.1 mL

Cas9 from Staphylococcus aureus, IgY prep, chicken

Sign In for Pricing
View Details