Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sorghum bicolor ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Sorghum bicolor ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A1E9R8

Expression Region

1-247

Origin

Sorghum bicolor (Sorghum) (Sorghum vulgare)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNITPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWFVITILLGSVIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 450 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
Uncoated Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit
E-UNEL-M0182-01 5x 96 Tests

Uncoated Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit
E-UNEL-M0182-02 15x 96 Tests

Uncoated Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit

Sign In for Pricing
View Details
TRITC Conjugated Rabbit Affinity Purified Antibody to Equine IgG, Fc Specific
RAF-532-1 1 mL

TRITC Conjugated Rabbit Affinity Purified Antibody to Equine IgG, Fc Specific

Sign In for Pricing
View Details
NKAIN1 Human Gene Knockout Kit (CRISPR)
KN418459 1 Kit

NKAIN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details