Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sorghum bicolor ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Sorghum bicolor ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A1E9R8

Expression Region

1-247

Origin

Sorghum bicolor (Sorghum) (Sorghum vulgare)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNITPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWFVITILLGSVIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC27A4 Rabbit Monoclonal Antibody
TA423382 100 µL

SLC27A4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS642928 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Osteopontin (SPP1) (59-74) Rabbit Polyclonal Antibody
AP02136SU-S 20 µL

Osteopontin (SPP1) (59-74) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NSE (ENO2) (NM_001975) Human Over-expression Lysate
LC400724 20 µg

NSE (ENO2) (NM_001975) Human Over-expression Lysate

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF647 conjugate, 0.1mg/mL
BNC472474-500 1x 500 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDK1 (NM_002610) Human Over-expression Lysate
LY400922 100 µg

PDK1 (NM_002610) Human Over-expression Lysate

Sign In for Pricing
View Details