Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Cobalamin synthase (cobS)

This Recombinant Escherichia coli Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

P36561

Expression Region

1-247

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG APLAALFSVLVLVLMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGESILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGS 22652
T70936-01 25 mg

CGS 22652

Sign In for Pricing
View Details
CGS 22652
T70936-02 50 mg

CGS 22652

Sign In for Pricing
View Details
CGS 22652
T70936-03 100 mg

CGS 22652

Sign In for Pricing
View Details
Anti-Erythropoietin EPO Antibody Picoband® Fluoro550 Conjugated
A00484-2-Fluoro550 100 µg/Vial

Anti-Erythropoietin EPO Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Chicken Antigen-Presenting Glycoprotein CD1D (CD1D) ELISA Kit
MBS9901290 Inquire

Chicken Antigen-Presenting Glycoprotein CD1D (CD1D) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal ENY2 Antibody (245)
NBP2-43547 0.1 mL

Mouse Monoclonal ENY2 Antibody (245)

Sign In for Pricing
View Details